This site uses cookies to provide logins and other features. Please accept the use of cookies by clicking Accept.
Tomato locus Le3OH-23b-hydroxylase
Locus details | Download GMOD XML | Note to Editors | Annotation guidelines |
[loading edit links...]
|
[loading...]
|
|
![]() ![]() |
Registry name: | None | [Associate registry name] |
![]() ![]() | [Add notes, figures or images] |
Success
The display image was set successfully.
Image | Description | Type |
---|
![]() ![]() | [Associate accession] |
Accession name:
Would you Like to specify an allele?
Alleles (0) | None | [Add new Allele] |
![]() ![]() | [Associate new locus] |
[loading...]
|
Associated loci - graphical view | None |
![]() ![]() |
[loading...]
![]() ![]() |
![]() ![]() |
![]() ![]() | unprocessed genomic sequence region underlying this gene |
>Solyc03g119910.2 SL2.50ch03:68457818..68459199
CTTCACATACAACTAAATTCCAATTCCAATTCCTCTTCTTCAATTCCAATAACTCCTAACTTCTACTACTATGCCTTCAATTATCTCATCACAACTCGATTTGTACTCGATAAAAGAATTACCCGAATCACATGCATGGAAATCCTCATTGGACGACGATGGATCGCGTAATATTAATGCGGAGTCCATTCCAGTAATCGATCTAAACCATGATCATAAATTTGTCATGGATACAATTGGCCATGCATGCAAAACATGGGGTGCCTTCCAAATAGTAAACCACAATATATCGCACCGATTACTTAACCATATGGAAACACACGGGACGAGATTATTTTCCCTTCCGATGCAACAAAAATTAAAAGCAGCTCGATCGTCCGATGGCATCGCTGGCTATGGAGTCGCTCGAATTTCTTCTTTTTTCGATAAGCTCATGTGGTCCGAAGGATTCACAATTTTTGGATCCCCTCTGGAACATGCCCGCCAACTTTGGCCATACGATTACAATAAATTCTGGTACACATTAATTAAACCCTATACAAAAAATATTAAATCCGTGCACCTACCTACACAATTTTTCGCCACTTTTTTTTTATAAAAAAAGTAACTATTTTTCGTATCTTTAATTATTATTTTTTTGAATTTTTCAGTGACGTCATCGAAGAGTACGAAAATGAAATGGAAAAGCTAGCGGGAAGATTAATGGGTTTAATGCTTGGGTCCCTTGGAATAGCAAAAGAAGATGTTAAATGGGCCGTTGGCCCAAGAAGCGGTAGTTCGGCCCTACAACTAAATTCTTACCCGGCTTGTCCGGATCCGGATCGGGCTATGGGTCTTGCTGCACATACGGATTCTACCCTATTAACAATCCTTCACCAAAACAATACAAGTGGTTTACAGGTATTTAAAGAAGGAAACGGGTGGGTAACGGTTCCTCCGCTTCGCGGGGCATTAGTTATCAACGTGGGTGATTTGTTACACATATTGTCAAACGGGTTGTACCCGAGTGTTCTACATCGGGCGATAGTGAACAGGACTCGACATCGTCTTTCAGTGGCCTATCTATATGGGCCACCGTCAGGGGTGAAAATTTCACCCCTATCGAAATTGGTAGACCAAAGGAACCCTCAAATGTATAGGCCAGTGACGTGGAGTGAGTATTTGGGAACTAAGGCAAAACATTTCGATAAAGCACTTTCATCTGTTCGGCTTTGTGCTCCTCGTATTGGGTTTGCCAATTCCAAGGATCAAAGTGGCGTCCAAGTAGGTTAATATAACAAGAAGTATCCACTTTTTTTTTTTTCCTGAAAATATCTCTCTACTTATGTTCCTTCTTGACCCATTGGAAGAATTTAGATCAATCTTTATCTTTGTGAGAACTT
CTTCACATACAACTAAATTCCAATTCCAATTCCTCTTCTTCAATTCCAATAACTCCTAACTTCTACTACTATGCCTTCAATTATCTCATCACAACTCGATTTGTACTCGATAAAAGAATTACCCGAATCACATGCATGGAAATCCTCATTGGACGACGATGGATCGCGTAATATTAATGCGGAGTCCATTCCAGTAATCGATCTAAACCATGATCATAAATTTGTCATGGATACAATTGGCCATGCATGCAAAACATGGGGTGCCTTCCAAATAGTAAACCACAATATATCGCACCGATTACTTAACCATATGGAAACACACGGGACGAGATTATTTTCCCTTCCGATGCAACAAAAATTAAAAGCAGCTCGATCGTCCGATGGCATCGCTGGCTATGGAGTCGCTCGAATTTCTTCTTTTTTCGATAAGCTCATGTGGTCCGAAGGATTCACAATTTTTGGATCCCCTCTGGAACATGCCCGCCAACTTTGGCCATACGATTACAATAAATTCTGGTACACATTAATTAAACCCTATACAAAAAATATTAAATCCGTGCACCTACCTACACAATTTTTCGCCACTTTTTTTTTATAAAAAAAGTAACTATTTTTCGTATCTTTAATTATTATTTTTTTGAATTTTTCAGTGACGTCATCGAAGAGTACGAAAATGAAATGGAAAAGCTAGCGGGAAGATTAATGGGTTTAATGCTTGGGTCCCTTGGAATAGCAAAAGAAGATGTTAAATGGGCCGTTGGCCCAAGAAGCGGTAGTTCGGCCCTACAACTAAATTCTTACCCGGCTTGTCCGGATCCGGATCGGGCTATGGGTCTTGCTGCACATACGGATTCTACCCTATTAACAATCCTTCACCAAAACAATACAAGTGGTTTACAGGTATTTAAAGAAGGAAACGGGTGGGTAACGGTTCCTCCGCTTCGCGGGGCATTAGTTATCAACGTGGGTGATTTGTTACACATATTGTCAAACGGGTTGTACCCGAGTGTTCTACATCGGGCGATAGTGAACAGGACTCGACATCGTCTTTCAGTGGCCTATCTATATGGGCCACCGTCAGGGGTGAAAATTTCACCCCTATCGAAATTGGTAGACCAAAGGAACCCTCAAATGTATAGGCCAGTGACGTGGAGTGAGTATTTGGGAACTAAGGCAAAACATTTCGATAAAGCACTTTCATCTGTTCGGCTTTGTGCTCCTCGTATTGGGTTTGCCAATTCCAAGGATCAAAGTGGCGTCCAAGTAGGTTAATATAACAAGAAGTATCCACTTTTTTTTTTTTCCTGAAAATATCTCTCTACTTATGTTCCTTCTTGACCCATTGGAAGAATTTAGATCAATCTTTATCTTTGTGAGAACTT
Download sequence region |
Get flanking sequences on SL2.50ch03
|
![]() ![]() |
![]() ![]() | terms associated with this mRNA |
![]() ![]() | spliced cDNA sequence, including UTRs |
>Solyc03g119910.2.1 Gibberellin 3-beta-hydroxylase (Fragment) (AHRD V1 **** D9ZZW4_9FABA); contains Interpro domain(s) IPR005123 Oxoglutarate and iron-dependent oxygenase
CTTCACATACAACTAAATTCCAATTCCAATTCCTCTTCTTCAATTCCAATAACTCCTAACTTCTACTACTATGCCTTCAATTATCTCATCACAACTCGATTTGTACTCGATAAAAGAATTACCCGAATCACATGCATGGAAATCCTCATTGGACGACGATGGATCGCGTAATATTAATGCGGAGTCCATTCCAGTAATCGATCTAAACCATGATCATAAATTTGTCATGGATACAATTGGCCATGCATGCAAAACATGGGGTGCCTTCCAAATAGTAAACCACAATATATCGCACCGATTACTTAACCATATGGAAACACACGGGACGAGATTATTTTCCCTTCCGATGCAACAAAAATTAAAAGCAGCTCGATCGTCCGATGGCATCGCTGGCTATGGAGTCGCTCGAATTTCTTCTTTTTTCGATAAGCTCATGTGGTCCGAAGGATTCACAATTTTTGGATCCCCTCTGGAACATGCCCGCCAACTTTGGCCATACGATTACAATAAATTCTGTGACGTCATCGAAGAGTACGAAAATGAAATGGAAAAGCTAGCGGGAAGATTAATGGGTTTAATGCTTGGGTCCCTTGGAATAGCAAAAGAAGATGTTAAATGGGCCGTTGGCCCAAGAAGCGGTAGTTCGGCCCTACAACTAAATTCTTACCCGGCTTGTCCGGATCCGGATCGGGCTATGGGTCTTGCTGCACATACGGATTCTACCCTATTAACAATCCTTCACCAAAACAATACAAGTGGTTTACAGGTATTTAAAGAAGGAAACGGGTGGGTAACGGTTCCTCCGCTTCGCGGGGCATTAGTTATCAACGTGGGTGATTTGTTACACATATTGTCAAACGGGTTGTACCCGAGTGTTCTACATCGGGCGATAGTGAACAGGACTCGACATCGTCTTTCAGTGGCCTATCTATATGGGCCACCGTCAGGGGTGAAAATTTCACCCCTATCGAAATTGGTAGACCAAAGGAACCCTCAAATGTATAGGCCAGTGACGTGGAGTGAGTATTTGGGAACTAAGGCAAAACATTTCGATAAAGCACTTTCATCTGTTCGGCTTTGTGCTCCTCGTATTGGGTTTGCCAATTCCAAGGATCAAAGTGGCGTCCAAGTAGGTTAATATAACAAGAAGTATCCACTTTTTTTTTTTTCCTGAAAATATCTCTCTACTTATGTTCCTTCTTGACCCATTGGAAGAATTTAGATCAATCTTTATCTTTGTGAGAACTT
CTTCACATACAACTAAATTCCAATTCCAATTCCTCTTCTTCAATTCCAATAACTCCTAACTTCTACTACTATGCCTTCAATTATCTCATCACAACTCGATTTGTACTCGATAAAAGAATTACCCGAATCACATGCATGGAAATCCTCATTGGACGACGATGGATCGCGTAATATTAATGCGGAGTCCATTCCAGTAATCGATCTAAACCATGATCATAAATTTGTCATGGATACAATTGGCCATGCATGCAAAACATGGGGTGCCTTCCAAATAGTAAACCACAATATATCGCACCGATTACTTAACCATATGGAAACACACGGGACGAGATTATTTTCCCTTCCGATGCAACAAAAATTAAAAGCAGCTCGATCGTCCGATGGCATCGCTGGCTATGGAGTCGCTCGAATTTCTTCTTTTTTCGATAAGCTCATGTGGTCCGAAGGATTCACAATTTTTGGATCCCCTCTGGAACATGCCCGCCAACTTTGGCCATACGATTACAATAAATTCTGTGACGTCATCGAAGAGTACGAAAATGAAATGGAAAAGCTAGCGGGAAGATTAATGGGTTTAATGCTTGGGTCCCTTGGAATAGCAAAAGAAGATGTTAAATGGGCCGTTGGCCCAAGAAGCGGTAGTTCGGCCCTACAACTAAATTCTTACCCGGCTTGTCCGGATCCGGATCGGGCTATGGGTCTTGCTGCACATACGGATTCTACCCTATTAACAATCCTTCACCAAAACAATACAAGTGGTTTACAGGTATTTAAAGAAGGAAACGGGTGGGTAACGGTTCCTCCGCTTCGCGGGGCATTAGTTATCAACGTGGGTGATTTGTTACACATATTGTCAAACGGGTTGTACCCGAGTGTTCTACATCGGGCGATAGTGAACAGGACTCGACATCGTCTTTCAGTGGCCTATCTATATGGGCCACCGTCAGGGGTGAAAATTTCACCCCTATCGAAATTGGTAGACCAAAGGAACCCTCAAATGTATAGGCCAGTGACGTGGAGTGAGTATTTGGGAACTAAGGCAAAACATTTCGATAAAGCACTTTCATCTGTTCGGCTTTGTGCTCCTCGTATTGGGTTTGCCAATTCCAAGGATCAAAGTGGCGTCCAAGTAGGTTAATATAACAAGAAGTATCCACTTTTTTTTTTTTCCTGAAAATATCTCTCTACTTATGTTCCTTCTTGACCCATTGGAAGAATTTAGATCAATCTTTATCTTTGTGAGAACTT
![]() ![]() | translated polypeptide sequence |
>Solyc03g119910.2.1 Gibberellin 3-beta-hydroxylase (Fragment) (AHRD V1 **** D9ZZW4_9FABA); contains Interpro domain(s) IPR005123 Oxoglutarate and iron-dependent oxygenase
MPSIISSQLDLYSIKELPESHAWKSSLDDDGSRNINAESIPVIDLNHDHKFVMDTIGHACKTWGAFQIVNHNISHRLLNHMETHGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFDKLMWSEGFTIFGSPLEHARQLWPYDYNKFCDVIEEYENEMEKLAGRLMGLMLGSLGIAKEDVKWAVGPRSGSSALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQNNTSGLQVFKEGNGWVTVPPLRGALVINVGDLLHILSNGLYPSVLHRAIVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQRNPQMYRPVTWSEYLGTKAKHFDKALSSVRLCAPRIGFANSKDQSGVQVG*
MPSIISSQLDLYSIKELPESHAWKSSLDDDGSRNINAESIPVIDLNHDHKFVMDTIGHACKTWGAFQIVNHNISHRLLNHMETHGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFDKLMWSEGFTIFGSPLEHARQLWPYDYNKFCDVIEEYENEMEKLAGRLMGLMLGSLGIAKEDVKWAVGPRSGSSALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQNNTSGLQVFKEGNGWVTVPPLRGALVINVGDLLHILSNGLYPSVLHRAIVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQRNPQMYRPVTWSEYLGTKAKHFDKALSSVRLCAPRIGFANSKDQSGVQVG*
![]() ![]() |
![]() ![]() | [Associate new unigene] |
Unigene ID:
[loading...]
![]() ![]() | [Associate new genbank sequence] |
AB010992 Solanum lycopersicum Le3OH-2 mRNA for 3b-hydroxylase, complete cds.
Other genome matches | None |
![]() ![]() | [Associate publication] [Matching publications] |
Regulation of gibberellin biosynthesis genes during flower and early fruit development of tomato.
The Plant journal : for cell and molecular biology (1999)
Show / hide abstract
Show / hide abstract
Gibberellins (GAs) are essential for the development of fertile flowers in tomato, and may also be required immediately after fertilization. In the GA-biosynthetic pathway, the reactions catalyzed by GA 20-oxidases have been implicated as site of regulation. To study the regulation of GA biosynthesis in flower and early fruit development, we isolated three tomato GA 20-oxidase cDNA clones, Le20ox-1, -2 and -3. The three genes showed different organ-specific patterns of mRNA accumulation. Analysis of the transcript levels of the three GA 20-oxidase genes, as well as those of copalyl diphosphate synthase (LeCPS) and GA 3 beta-hydroxylase (Le3OH-2) during flower bud and early fruit development, revealed temporally distinct patterns of mRNA accumulation. Up until anthesis, transcripts were observed for LeCPS, Le20ox-1, -2 and Le3OH-2, with an accumulation of Le20ox-1 mRNA. In contrast to the high level of Le3OH-2 transcripts in the fully open flower, mRNA levels of Le20ox-1, -2 and LeCPS were reduced at this stage. After anthesis, LeCPS and Le20ox-1 transcripts increased again. In addition, Le20ox-3transcripts increased whereas the transcripts of Le3OH-2 decreased to an undetectable level. In situ hybridization results demonstrated that during early stages of bud development, Le20ox-2 transcripts were localized in the tapetum and placenta. The presented results supply novel data about localization of GA biosynthesis gene transcripts, and indicate that transcript levels of GA biosynthesis genes are all highly regulated during flower bud development.
Rebers, M. Kaneta, T. Kawaide, H. Yamaguchi, S. Yang, YY. Imai, R. Sekimoto, H. Kamiya, Y.
The Plant journal : for cell and molecular biology.
1999.
17(3).
241-50.
Tomato fruit set driven by pollination or by the parthenocarpic fruit allele are mediated by transcriptionally regulated gibberellin biosynthesis.
Planta (2007)
Show / hide abstract
Show / hide abstract
We investigated the role of gibberellins (GAs) in the phenotype of parthenocarpic fruit (pat), a recessive mutation conferring parthenocarpy in tomato (Solanum lycopersicum L.). Novel phenotypes that parallel those reported in plants repeatedly treated with gibberellic acid or having a GA-constitutive response indicate that the pat mutant probably expresses high levels of GA. The retained sensitivity to the GA-biosynthesis inhibitor paclobutrazol reveals that this condition is dependent on GA biosynthesis. Expression analysis of genes encoding key enzymes involved in GA biosynthesis shows that in normal tomato ovaries, the GA20ox1 transcript is in low copy number before anthesis and only pollination and fertilization increase its transcription levels and, thus, GA biosynthesis. In the unpollinated ovaries of the pat mutant, this mechanism is de-regulated and GA20ox1 is constitutively expressed, indicating that a high GA concentration could play a part in the parthenocarpic phenotype. The levels of endogenous GAs measured in the floral organs of the pat mutant support such a hypothesis. Collectively, the data indicate that transcriptional regulation of GA20ox1 mediates pollination-induced fruit set in tomato and that parthenocarpy in pat results from the mis-regulation of this mechanism. As genes involved in the control of GA synthesis (LeT6, LeT12 and LeCUC2) and response (SPY) are also altered in the pat ovary, it is suggested that the pat mutation affects a regulatory gene located upstream of the control of fruit set exerted by GAs.
Olimpieri, I. Siligato, F. Caccia, R. Mariotti, L. Ceccarelli, N. Soressi, GP. Mazzucato, A.
Planta.
2007.
226(4).
877-88.
Changes in tomato ovary transcriptome demonstrate complex hormonal regulation of fruit set.
The New phytologist (2008)
Show / hide abstract
Show / hide abstract
Plant hormones are considered to be important mediators of the fruit developmental signal after pollination. The role of phytohormones in tomato (Solanum lycopersicum) fruit set was investigated here. Transcriptome analysis of ovaries was performed using two complementary approaches: cDNA-amplified fragment length polymorphism (AFLP) and microarray analysis. The gene expression profiles obtained suggest that, in addition to auxin and gibberellin, ethylene and abscisic acid (ABA) are involved in regulating fruit set. Before fruit development, many genes involved in biotic and abiotic responses are active in the ovary. In addition, genes involved in ethylene and ABA biosynthesis were strongly expressed, suggesting relatively high ethylene and ABA concentrations before fruit set. Induction of fruit development, either by pollination or by gibberellin application, attenuated expression of all ethylene and ABA biosynthesis and response genes within 24 h. It is proposed that the function of ABA and ethylene in fruit set might be antagonistic to that of auxin and gibberellin in order to keep the ovary in a temporally protected and dormant state; either to protect the ovary tissue or to prevent fruit development before pollination and fertilization occur.
Vriezen, WH. Feron, R. Maretto, F. Keijman, J. Mariani, C.
The New phytologist.
2008.
177(1).
60-76.
The role of auxin and gibberellin in tomato fruit set.
Journal of experimental botany (2009)
Show / hide abstract
Show / hide abstract
The initiation of tomato fruit growth, fruit set, is very sensitive to environmental conditions. Therefore, an understanding of the mechanisms that regulate this process can facilitate the production of this agriculturally valuable fruit crop. Over the years, it has been well established that tomato fruit set depends on successful pollination and fertilization, which trigger the fruit developmental programme through the activation of the auxin and gibberellin signalling pathways. However, the exact role of each of these two hormones is still poorly understood, probably because only few of the signalling components involved have been identified so far. Recent research on fruit set induced by hormone applications has led to new insights into hormone biosynthesis and signalling. The aim of this review is to consolidate the current knowledge on the role of auxin and gibberellin in tomato fruit set.
de Jong, M. Mariani, C. Vriezen, WH.
Journal of experimental botany.
2009.
60(5).
1523-32.
![]() ![]() | [Add ontology annotations] |
[loading...]
![]() ![]() |
User comments |
Please wait, checking for comments. (If comments do not show up, access them here)
Your Lists
Public Lists
List Contents
List Validation Report: Failed
Elements not found:
Optional: Add Missing Accessions to A List
Mismatched case
Click the Adjust Case button to align the case in the list with what is in the database.
Multiple mismatched case
Items listed here have mulitple case mismatches and must be fixed manually. If accessions need to be merged, contact the database directly.
List elements matching a synonym
Multiple synonym matches
Fuzzy Search Results
Synonym Search Results
Available Seedlots
Your Datasets
Public Datasets
Dataset Contents
Dataset Validation Failed
Elements not found:
Your Calendar
Having trouble viewing events on the calendar?
Are you associated with the breeding program you are interested in viewing?
Add New Event
Event Info
Attribute | Value |
---|---|
Project Name: | |
Start Date: | |
End Date: | |
Event Type: | |
Event Description: | |
Event Web URL: |
Edit Event
Login
Forgot Username
If you've forgotten your username, enter your email address below. An email will be sent with any account username(s) associated with your email address.
Reset Password
To reset your password, please enter your email address. A link will be sent to that address with a link that will enable you to reset your password.
Create New User
Working
