##gff-version 3
# This output was generated with AUGUSTUS (version 2.3).
# AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de)
# and Oliver Keller (keller@cs.uni-goettingen.de).
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Initialising the parameters ...
# tomato version. Use default transition matrix.
# Looks like /tmp/bac-submission-temp-C03HBa0141L10-na2fQ/AUGUSTUS_ab_initio/seq_with_defline_removed is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 36460, name = C03HBa0141L10.1) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
C03HBa0141L10.1	AUGUSTUS_ab_initio	gene	546	806	0.99	+	.	ID=g1
C03HBa0141L10.1	AUGUSTUS_ab_initio	transcript	546	806	0.99	+	.	ID=g1.t1;Parent=g1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	1	545	1	+	.	Parent=g1.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	546	806	0.99	+	0	ID=g1.t1.cds;Parent=g1.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	stop_codon	804	806	.	+	0	Parent=g1.t1
# protein sequence = [EVKVEKLIGTRFLVKVTCKKGKDVLVSILEAFEDMKLIVVQARVTSRYFFGMEAIVEAENEATLDVRALTRALQMSIH
# KQSFENFK]
# end gene g1
###
# start gene g2
C03HBa0141L10.1	AUGUSTUS_ab_initio	gene	5172	6170	1	+	.	ID=g2
C03HBa0141L10.1	AUGUSTUS_ab_initio	transcript	5172	6170	1	+	.	ID=g2.t1;Parent=g2
C03HBa0141L10.1	AUGUSTUS_ab_initio	start_codon	5172	5174	.	+	0	Parent=g2.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	5172	6170	1	+	0	ID=g2.t1.cds;Parent=g2.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	stop_codon	6168	6170	.	+	0	Parent=g2.t1
# protein sequence = [MTTPQTSPPKYLQEDSLSEECKELLSTLPKEKGWIGSYIYKYQGFWTSPRLIQGVIACQQQFQAQDTDIILVTTPKSG
# TTWLKSLLFALVNRTKHSVFEQNHPLLVKNPHILVPFLEHTLYVDGRVPDFSSFASPRLLATHVPFASLPKSIQDSETKLVYLCRNPRDTFISMWHFS
# NNLRLNHKDTNSIEEMFDLFCKGVSIYGPFWDHVLDYWKQSVENPNKVLFLMYEEMKENPKIQLKRLAEFLECQFSIEEERCGVVDEILKMCSFENLS
# NLEVNTNEKLSTGEGNKTFFRKGEIGDWKNYFTVEMSEKLNHITEEKFHGSGLKFLYT]
# end gene g2
###
# start gene g3
C03HBa0141L10.1	AUGUSTUS_ab_initio	gene	20924	21646	0.56	+	.	ID=g3
C03HBa0141L10.1	AUGUSTUS_ab_initio	transcript	20924	21646	0.56	+	.	ID=g3.t1;Parent=g3
C03HBa0141L10.1	AUGUSTUS_ab_initio	start_codon	20924	20926	.	+	0	Parent=g3.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	20924	21646	0.56	+	0	ID=g3.t1.cds;Parent=g3.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	stop_codon	21644	21646	.	+	0	Parent=g3.t1
# protein sequence = [MTTPQTSPPKYLQEDSLSEECKELLSTLPKEKGWIGSYIYKYQGFWTSPRLIQGVIACQQQFQAQDTDIILVTTPKSG
# TTWLKSLLFALVNRTKHSVFEQNHPLLVKNPHILVPFLEHTLYVDGRVPDFSSFASPRLLATHVPFASLPKSIQDSETKLVYLCRNPRDTFISMWHFS
# NNLRLNHKDTNSIEEMFDLFCKGGSIYGPFWDHVLDYWKQSVENPNKVLFLMYERNERESKNST]
# end gene g3
###
# start gene g4
C03HBa0141L10.1	AUGUSTUS_ab_initio	gene	24043	26272	0.36	+	.	ID=g4
C03HBa0141L10.1	AUGUSTUS_ab_initio	transcript	24043	26272	0.36	+	.	ID=g4.t1;Parent=g4
C03HBa0141L10.1	AUGUSTUS_ab_initio	start_codon	24043	24045	.	+	0	Parent=g4.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	25258	25778	0.4	+	.	Parent=g4.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	25824	26179	0.68	+	.	Parent=g4.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	24043	25257	0.49	+	0	ID=g4.t1.cds;Parent=g4.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	25779	25823	0.7	+	0	ID=g4.t1.cds;Parent=g4.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	26180	26272	0.96	+	0	ID=g4.t1.cds;Parent=g4.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	stop_codon	26270	26272	.	+	0	Parent=g4.t1
# protein sequence = [MASSSPDPFFLLIFFTLFLTISTSNSLSSSSPSPLSSPSPKPSPISSPPTHSSSSALDPKQLKALQSLNIPTGKSPCS
# PSHNTTTICDSSTPFSHIVSLNFINCSDDVALSLTALKSLSTVKDLGFYNCPISPIRLPSQLALNLKSFTCVSSLKKLTGVWLSKLVNVTDLTVSHVS
# IVASGPSIIMNSIKNLHSVTISNANLTGYLPKHWHSNLSYVDLSGNKLKGRIPTSLTELENLVYLNLSSNSLNGTIPASFGDLSSLQNVSLASNSLSG
# SVPDSFAAIPGLVHLDLGSNQLNGTIPKFISDMKGLKYLNLERNNFHGVLPFNASFIKKLAVLKVGENSNLCYNHSTLSSKVKLGIAPCDKHGLPMSP
# PASKDINSDDTDDSDDYADDESQHQEHSHGPSKSLEYFAWKRLTYPYQVCVDPPEFCIFGGSDTGGATLLEGPSNKAP]
# end gene g4
###
# start gene g5
C03HBa0141L10.1	AUGUSTUS_ab_initio	gene	29016	36290	0.02	-	.	ID=g5
C03HBa0141L10.1	AUGUSTUS_ab_initio	transcript	29016	36290	0.02	-	.	ID=g5.t1;Parent=g5
C03HBa0141L10.1	AUGUSTUS_ab_initio	stop_codon	29016	29018	.	-	0	Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	29034	29160	0.23	-	.	Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	29333	30916	0.94	-	.	Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	31381	34240	0.53	-	.	Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	34343	34558	0.56	-	.	Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	34643	35436	0.99	-	.	Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	35533	35603	1	-	.	Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	35655	35766	1	-	.	Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	intron	35908	36200	0.64	-	.	Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	29016	29033	0.23	-	0	ID=g5.t1.cds;Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	29161	29332	0.96	-	1	ID=g5.t1.cds;Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	30917	31380	0.55	-	0	ID=g5.t1.cds;Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	34241	34342	0.99	-	0	ID=g5.t1.cds;Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	34559	34642	0.99	-	0	ID=g5.t1.cds;Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	35437	35532	1	-	0	ID=g5.t1.cds;Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	35604	35654	1	-	0	ID=g5.t1.cds;Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	35767	35907	0.75	-	0	ID=g5.t1.cds;Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	CDS	36201	36290	0.39	-	0	ID=g5.t1.cds;Parent=g5.t1
C03HBa0141L10.1	AUGUSTUS_ab_initio	start_codon	36288	36290	.	-	0	Parent=g5.t1
# protein sequence = [MSLNIIYHMEFTNFLSELSSKMLALLGRDHVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQP
# LFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCNALEACAHPFFDELREPNARLPHG
# RQLPPLFNFKQERGRELIKVGILLLLIDWLNGSLREVMDKEMDVRNQKMDVPETLVTIRLDEDGETGKSRIGVEDGDSEGNEVKVKDSKKGDDFSAVI
# DVKCDGGDGKLGEDLEGDAQRVCRICHLSTYEAEKNLVDLIELGCGCKGELGFVHSHCAEAWFKLKGNRVCEICGEVAQNVTGVSNNRFIEEWNDARS
# TASGVGSTETTRGCWHGQPFCNFLMACLYLQPP]
# end gene g5
###
# command line:
# /usr/bin/augustus.real --species=tomato --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C03HBa0141L10-na2fQ/AUGUSTUS_ab_initio/seq_with_defline_removed