##gff-version 3
# This output was generated with AUGUSTUS (version 2.3).
# AUGUSTUS is a gene prediction tool for eukaryotes written by Mario Stanke (mstanke@gwdg.de)
# and Oliver Keller (keller@cs.uni-goettingen.de).
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Initialising the parameters ...
# tomato version. Use default transition matrix.
# Looks like /tmp/bac-submission-temp-C03HBa0004C15-gV6FC/AUGUSTUS_ab_initio/seq_with_defline_removed is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 158605, name = C03HBa0004C15.1) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
C03HBa0004C15.1	AUGUSTUS_ab_initio	gene	55057	55377	0.93	-	.	ID=g1
C03HBa0004C15.1	AUGUSTUS_ab_initio	transcript	55057	55377	0.93	-	.	ID=g1.t1;Parent=g1
C03HBa0004C15.1	AUGUSTUS_ab_initio	stop_codon	55057	55059	.	-	0	Parent=g1.t1
C03HBa0004C15.1	AUGUSTUS_ab_initio	CDS	55057	55377	0.93	-	0	ID=g1.t1.cds;Parent=g1.t1
C03HBa0004C15.1	AUGUSTUS_ab_initio	start_codon	55375	55377	.	-	0	Parent=g1.t1
# protein sequence = [MVQLTHSADYRAPRLESSIPGIIKAAMVDVVTPLRATIDAMAVRTAVYENGQGTTKEVKALQASIPELMKDVDQLKST
# DMSMDLGTLDIHDVPKMPPSTNIDDVRV]
# end gene g1
###
# start gene g2
C03HBa0004C15.1	AUGUSTUS_ab_initio	gene	76582	76914	0.14	-	.	ID=g2
C03HBa0004C15.1	AUGUSTUS_ab_initio	transcript	76582	76914	0.14	-	.	ID=g2.t1;Parent=g2
C03HBa0004C15.1	AUGUSTUS_ab_initio	stop_codon	76582	76584	.	-	0	Parent=g2.t1
C03HBa0004C15.1	AUGUSTUS_ab_initio	CDS	76582	76914	0.14	-	0	ID=g2.t1.cds;Parent=g2.t1
C03HBa0004C15.1	AUGUSTUS_ab_initio	start_codon	76912	76914	.	-	0	Parent=g2.t1
# protein sequence = [MFILTQVPFDAKRMWKLLPHLEPKKKSDPMYSSPTVDTAALLACAVLPTSDPGHSFIASVDSMTSSSSFTSCPLCLVL
# LMLCDTHSRRLHYYEWGIYPILQIGVHPSLRP]
# end gene g2
###
# start gene g3
C03HBa0004C15.1	AUGUSTUS_ab_initio	gene	77725	78189	0.88	-	.	ID=g3
C03HBa0004C15.1	AUGUSTUS_ab_initio	transcript	77725	78189	0.88	-	.	ID=g3.t1;Parent=g3
C03HBa0004C15.1	AUGUSTUS_ab_initio	stop_codon	77725	77727	.	-	0	Parent=g3.t1
C03HBa0004C15.1	AUGUSTUS_ab_initio	CDS	77725	78189	0.88	-	0	ID=g3.t1.cds;Parent=g3.t1
C03HBa0004C15.1	AUGUSTUS_ab_initio	start_codon	78187	78189	.	-	0	Parent=g3.t1
# protein sequence = [MFSPNNVVDSPKGPSHHRPTIFLERFRDNPFGEPYLACQSDSRLADRFGESSCSLFFCIFLELFLTFYDVFADVSKTK
# VVGKDILLCKRSKGITIHEDETTSWEKANKLPTIGGNGKGNGRAPVPASPKVNSDSDGVYATYLTTSKSEGEHQYP]
# end gene g3
###
# command line:
# /usr/bin/augustus.real --species=tomato --extrinsicCfgFile=extrinsic.ME.cfg --gff3=on /tmp/bac-submission-temp-C03HBa0004C15-gV6FC/AUGUSTUS_ab_initio/seq_with_defline_removed