BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 159758 (398 letters) Database: ../database/ATH1_pep_20030417 28,581 sequences; 12,141,370 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53880.1 43 6e-05 At5g52450.1 26 6.2 At4g22756.1 26 8.1 At3g44340.1 26 8.1 >At5g53880.1 Length = 67 Score = 42.7 bits (99), Expect = 6e-05 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 2 KFLFQCPCCSCFCFM 46 KFLFQCPCCSCFCFM Sbjct: 2 KFLFQCPCCSCFCFM 16 >At5g52450.1 Length = 487 Score = 26.2 bits (56), Expect = 6.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 229 YCSSFTSSLKYLLCAIAIFNS 291 +CS T+SL LLC + +F S Sbjct: 181 FCSGVTTSLHVLLCWVLVFKS 201 >At4g22756.1 Length = 300 Score = 25.8 bits (55), Expect = 8.1 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Frame = -1 Query: 293 KELKIAIAHNK------YFKLEVNEEQYYLYEHNI*LHYLIAS 183 +E IA++ N +F + YYLY HNI +LI S Sbjct: 8 EEASIALSRNLTWLETLWFDYSATKSDYYLYCHNILFLFLIFS 50 >At3g44340.1 Length = 1097 Score = 25.8 bits (55), Expect = 8.1 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 175 MKEEAMR*CNYILCSYK*YCSSFTSSLKYLL 267 +KE+A C IL SY+ +C++ TS+ + +L Sbjct: 869 VKEQATNDCITILHSYRKFCATVTSTGQLIL 899 Database: ../database/ATH1_pep_20030417 Posted date: Feb 16, 2004 1:44 PM Number of letters in database: 12,141,370 Number of sequences in database: 28,581 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,297,703 Number of Sequences: 28581 Number of extensions: 64320 Number of successful extensions: 127 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 12,141,370 effective HSP length: 88 effective length of database: 9,626,242 effective search space used: 423554648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= stgn_195637 (408 letters) Database: ../database/ATH1_pep_20030417 28,581 sequences; 12,141,370 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53880.1 45 2e-05 >At5g53880.1 Length = 67 Score = 44.7 bits (104), Expect = 2e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 9 MKFLFQCPCCSCFCFM 56 MKFLFQCPCCSCFCFM Sbjct: 1 MKFLFQCPCCSCFCFM 16 Database: ../database/ATH1_pep_20030417 Posted date: Feb 16, 2004 1:44 PM Number of letters in database: 12,141,370 Number of sequences in database: 28,581 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,056,779 Number of Sequences: 28581 Number of extensions: 75883 Number of successful extensions: 172 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 172 length of database: 12,141,370 effective HSP length: 89 effective length of database: 9,597,661 effective search space used: 441492406 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cangn_201215 (410 letters) Database: ../database/ATH1_pep_20030417 28,581 sequences; 12,141,370 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53880.1 46 8e-06 >At5g53880.1 Length = 67 Score = 45.8 bits (107), Expect = 8e-06 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 2 FLFQCPCCSCFCFMKPQ 52 FLFQCPCCSCFCFMKP+ Sbjct: 3 FLFQCPCCSCFCFMKPK 19 Database: ../database/ATH1_pep_20030417 Posted date: Feb 16, 2004 1:44 PM Number of letters in database: 12,141,370 Number of sequences in database: 28,581 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,489,336 Number of Sequences: 28581 Number of extensions: 59721 Number of successful extensions: 124 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 12,141,370 effective HSP length: 89 effective length of database: 9,597,661 effective search space used: 451090067 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= cgn_122752 (411 letters) Database: ../database/ATH1_pep_20030417 28,581 sequences; 12,141,370 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53880.1 45 2e-05 At4g03020.1 30 0.46 At5g51930.1 27 5.0 At2g13720.1 26 8.6 >At5g53880.1 Length = 67 Score = 44.7 bits (104), Expect = 2e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 33 MKFLFQCPCCSCFCFM 80 MKFLFQCPCCSCFCFM Sbjct: 1 MKFLFQCPCCSCFCFM 16 >At4g03020.1 Length = 494 Score = 30.0 bits (66), Expect = 0.46 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = -1 Query: 381 NGYARINSHLSTLGQATCLVTRVR-----RNSIQI*EKHTIASTTIRLLNGRK*NHKGK* 217 +G R + HL+ L VT+++ R S ++ +H + +T+R+L GR+ N G+ Sbjct: 40 SGSHRSSEHLADLDHEISQVTKLKSSPHQRYSREVPGRHQLPVSTVRMLAGRESNFSGRG 99 Query: 216 R 214 R Sbjct: 100 R 100 >At5g51930.1 Length = 583 Score = 26.6 bits (57), Expect = 5.0 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 325 GNPSTS*LDTDLGKTYNCFYHHSPVEWSQI 236 G+P + TD+G + N +++P WSQ+ Sbjct: 104 GSPYENPTATDMGNSVNTLLNNTPNSWSQL 133 >At2g13720.1 Length = 224 Score = 25.8 bits (55), Expect = 8.6 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 8/58 (13%) Frame = -2 Query: 341 DKQHAW*PEYVVTRYRFRKNIQLLLPPFAC*MVA--------NKIIRVNKENKLLKKS 192 DKQ W +YV + K Q++ F + K I +NK+N +LKK+ Sbjct: 140 DKQKKWIEKYVPGTFLDSKKQQIMYSDFVTKKLKLYFTTSNQRKHININKKNYILKKN 197 Database: ../database/ATH1_pep_20030417 Posted date: Feb 16, 2004 1:44 PM Number of letters in database: 12,141,370 Number of sequences in database: 28,581 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,121,531 Number of Sequences: 28581 Number of extensions: 104974 Number of successful extensions: 243 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 243 length of database: 12,141,370 effective HSP length: 89 effective length of database: 9,597,661 effective search space used: 451090067 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.6 [Apr-09-2003] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= At5g53880.1 (201 letters) Database: ../database/ATH1_pep_20030417 28,581 sequences; 12,141,370 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53880.1 72 5e-14 At3g02210.1 25 6.5 >At5g53880.1 Length = 67 Score = 72.4 bits (176), Expect = 5e-14 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 MKFLFQCPCCSCFCFMKPKPGKPKAVGDT 87 MKFLFQCPCCSCFCFMKPKPGKPKAVGDT Sbjct: 1 MKFLFQCPCCSCFCFMKPKPGKPKAVGDT 29 >At3g02210.1 Length = 453 Score = 25.4 bits (54), Expect = 6.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 4 KFLFQCPCCSCFCFMKPKPG 63 K + CP CSC C +PG Sbjct: 240 KTIVSCPTCSCGCRNTSQPG 259 Database: ../database/ATH1_pep_20030417 Posted date: Feb 16, 2004 1:44 PM Number of letters in database: 12,141,370 Number of sequences in database: 28,581 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,914,056 Number of Sequences: 28581 Number of extensions: 16179 Number of successful extensions: 88 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 12,141,370 effective HSP length: 42 effective length of database: 10,940,968 effective search space used: 262583232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)